PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011099869.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family SBP
Protein Properties Length: 1081aa    MW: 120112 Da    PI: 7.4544
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011099869.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.84.3e-40157234178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqv++C++dls+ak+yhrrhkvCevhska ++lv +++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrr+k++
  XP_011099869.1 157 VCQVDNCNEDLSTAKDYHRRHKVCEVHSKAVKALVGQQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRRKTQ 234
                     6************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.0E-34152219IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.821155232IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.62E-36156233IPR004333Transcription factor, SBP-box
PfamPF031101.6E-29158232IPR004333Transcription factor, SBP-box
SuperFamilySSF484032.69E-6829969IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.205.4E-5829984IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1081 aa     Download sequence    Send to blast
MMEDLGAQLV APTVIHQSLS GRFCDSYPMP KKRGLPFHSS TYIHQNASDN WNPKFWDWDS  60
SRFVAKPLQC DEIHAGNGTQ IHPGLPRRKE LQINAQNPRK LDSAGEDNEN LRLKLGGGDG  120
ARSDSSSGVV NLMEPQPVSR PNKRVRSGSP GGANYPVCQV DNCNEDLSTA KDYHRRHKVC  180
EVHSKAVKAL VGQQMQRFCQ QCSRFHPLSE FDEGKRSCRR RLAGHNRRRR RKTQPEDSAA  240
RLLVPGSHEN NVGDIDVAKL LAVLARVQGN PEDRSSKVAS IPDKDQLIQI LSKISSLPLP  300
ADVTARLRGS IPNLLSSENL NQMNGNASSR STMNLLAVLS ATPGVPSFDA FANHSQPSTE  360
GSDSEKSKSV CVDQAARLNV HRGPMMESPT VGGERTSTSY DSPMEEVDFH VQETSPSLPL  420
QLFTPSPEDY RSTKSPSYRN FLSCGSSNHS EERSPMSSPP VVHDLFPMQT SREIMKDKHL  480
SNSEGEIANA KQTISNECST SLQLFRDSTL ATENGSNQSS PYQAGYTSSS GSDHSPSSLN  540
SDAQDRNGRI IFKLFDKDPS YMPRSLRAQI YNWLSNSPSE MESYIRPGCI VLSLYLSMPS  600
FAWDQLEENL LNYVKSLVKD IDVDFWGNGR FLVHTDRQMA SHKDGRIRLC KSWRAWSTPE  660
LISVSPLAVV GGQETSLLLR GRSLTGPGTK IHCTHASEYN IRQVAASSCL DSAYEEISLD  720
SFKVDRAASG VLGRCFIEVE NSFRGTSFPV IIADDTICEE LRLLEPGING TAEVCGGIAA  780
DHIHNTGRPR SREEILHFLD ELGWLFQRKH NSFLFGIPDY RLSRFRFLLI FSVEHDFCAV  840
VKTLLDILLE LNLVRHGLAR QSLEMLSEIH LLNRAVKRRC RSMVDLLIHY SVDSTDTYEK  900
YIFLPNMAGP GGVTPLHLAA CMSSSDDMVD ALTSDPQEMG LQSWNSVLDA NGLSPYAYAL  960
MRNNHSYNAL VARKLADRNN CQISVSVNDE IEQVELEKDK DKRTISHFNQ KLKSCSRCSV  1020
LASCGYSKRF LGSKGLLQRP YIHSMLVVAA VCVCVCLFLR GHPSVGCVSP FVWDNLGYGA  1080
F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-31148231184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1873878RAVKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099860.10.0PREDICTED: squamosa promoter-binding-like protein 14
RefseqXP_011099869.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A075FJP10.0A0A075FJP1_SALMI; SQUAM
STRINGVIT_18s0122g00380.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14